SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_018_00069.1|PACid:22041026 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_018_00069.1|PACid:22041026
Domain Number 1 Region: 649-970
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-67
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 280-626
Classification Level Classification E-value
Superfamily RNI-like 4e-60
Family Cyclin A/CDK2-associated p19, Skp2 0.027
Further Details:      
 
Domain Number 3 Region: 43-341
Classification Level Classification E-value
Superfamily L domain-like 2.38e-57
Family Polygalacturonase inhibiting protein PGIP 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_018_00069.1|PACid:22041026
Sequence length 970
Sequence
MDAISTQTSFKQLIWLFCFICMLFLSSFKSGLAALLVTVSSRKESDRFALLEIKYQIHND
PLGALTSWNDSLHHCDWQGITCSRRHRERVTLLNLENKKLEGTLSPYIGNLSFLKVIRLT
KNNFYGEIPQEIGRLFRLQHLVLNNNSFQGEIPSNITYCSDLIQINLVDNKLSGSIFAGF
SSLSKLIQLGLSKNNFNGKIPPSLGNLTSLFVLALHGNHLEGNIPDDVCNIRSLGFFQVG
QNNLTGKIPSCLFNHSSIFCFACTGNRLEGSLPPNIGLTLPNLQEFWLGSNKFSGPIPVS
LSNATRLEVISFVDNAFTGSVPRDLGKLQRLRWLVFGGNQIGTQQGGDDLNFINSLTNCS
KLEILELAQNVLKGPLPDSISNLSSTTIWYLNMEENSIYGSIPVGIGNLNNIEVISFAIN
NLTGVIPTTIGKLNQLKELYLGFNLLSGQIPSSMGNLTQLTELSLSENNLSGSIPPTLGN
CQTLGVLDLSQNNLIGTIPIQVFRLSSLTIGLALSHNSLTGSLPLEVGNLTNIVSLLISD
NKLSGHIPESLGNCLNLVELSMEGNIFEGEIPKSLTSLGGLKYLDLSRNNLSGNIPQYLE
QFPDLGYLNLSFNQLEGWVPRNGVFANASLVSVDGNHNLCGVFNKNASSSTLSNIPSYKR
ISYLELFRATNGFSMDYLIGVGSYGSVFKGILQDINQTVAVKVLNLQREGAFKSFLTECN
ALRHLRHRNLLKIITACSSVDFQGNDFRALVFEFMPYGSLEEWLHPIVNEQQHDSRNLSF
IQRLNIAIDVASALDYLHNRCQPGVVHCDLKPSNVLLDDDMTARVADFGIAKMFSAASYD
SAQSQPSSDVIRGSIGYVAPEYGMGIQVSMEGDVYSYGILLLEMFTRKRPTDDIFLNGLS
LHNYAEMALPNQVMGIIDPLLLLEHNTEVVNSVEQSNTGDRLEECLVSAITVGVTCSAEA
PTGRMTMDHV
Download sequence
Identical sequences A0A2G5DKI4
Aquca_018_00069.1|PACid:22041026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]