SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_018_00078.1|PACid:22041020 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_018_00078.1|PACid:22041020
Domain Number 1 Region: 105-147
Classification Level Classification E-value
Superfamily F-box domain 0.0000471
Family F-box domain 0.0076
Further Details:      
 
Weak hits

Sequence:  Aquca_018_00078.1|PACid:22041020
Domain Number - Region: 230-297
Classification Level Classification E-value
Superfamily Saposin 0.0667
Family NKL-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_018_00078.1|PACid:22041020
Sequence length 513
Sequence
MGNRNPCNSNSTSSSSSLLDILASLASEETENEVIMNQHPYPVARRTGPKSFRALLKQQE
GQFKKKKTTKRNKAPITVHPINQILLAPIQGNHFTHSQHMSLQTEDDHTDWAGLPVGLVH
DISKRLPVLSALSMAAACKSWSYVITDLVPNYHKRGLPWILLSGQNDTKVRTCFSVLENR
VMELNIPEAFGKCCWGSIQDWLLIAETIHGELYSFFFNPFSRIKFHLPKVGSLYFKMLLS
ASPTDPNCVFVLLCKKGTHFVCWTPGVHIWRQEYLGLDAFDDAVFCNGCFYFVNYEYNIR
IVDAQTMVSAMKKDLHAKRFTDLRLHFSFYQVAIPERPPRCRLRRYLVESCGEVLLVCRI
FGHRDGKILNTRRFEVFKLDACKMVWVKLESLGDRVLFIGKTDSRSLSAKELGINIANCI
FFLSDEMGSLHRWTNEWDASRRCSSVDDWGVFSLGSNSFIPDSCYRMDTDLLPPIWITAP
IWWYLSHHNPQIHRDANGIVSFFDLFYYFLQLL
Download sequence
Identical sequences A0A2G5DJV6
Aquca_018_00078.1|PACid:22041020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]