SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00014.4|PACid:22025335 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00014.4|PACid:22025335
Domain Number 1 Region: 352-663
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.42e-38
Family WD40-repeat 0.00099
Further Details:      
 
Domain Number 2 Region: 841-1100
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-33
Family WD40-repeat 0.003
Further Details:      
 
Weak hits

Sequence:  Aquca_020_00014.4|PACid:22025335
Domain Number - Region: 84-136
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0475
Family cAMP-binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00014.4|PACid:22025335
Sequence length 1137
Sequence
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF
TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFASFNEELFKEITQLLT
LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN
WQHQLCKNPRPNPDIKTLFVDHTCGQPNGALAPSPANSSLLSMPKAGGFPPLGAHGPFQP
APAPVPTPLAGWMSNPATVPHPAVSGGAIGLGAPTNPAAMLKHPRTPPSNHVDYPSGDSD
HVAKRTRPLGISDEVNLPVSISPVTYMGQSHNSAFSTDDLPKTVARTFSQGSSPMSMDFH
PRQQTLLLVGTNVGDIALWEVGSRERLFLRNFKVWDLGACSMPLQASLVKDPSVAVNRII
WNPDGSLFGVAYSRHIVQIYAYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVVTCGD
DKTIKVWDAATGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLGSRV
DYDAPGHWCTTMAYSADGSRLFSCGTSKDGESYIVEWNESEGAVKRTYLGFRKRSAGVVQ
FDTTKNRFLAAGDEFVIKIWDMDNVNLLTTMDAEGGLPASPRIRFNKEGTLLAVSANDNA
IKVLATTDGLRLLRTFENRSFDASRAASEAVSKPSINPISAAAAAAAAAATSAGHADIGA
SVVSISGMNGDARNMGDVKPRITEEANDKSKIWKLTEISDGAQCRTMRLPDSIRSSKISR
LIYTNTGTAILGLASNAVHFLWKWQRNERNSSGKATANVPPTLWQPSSGILMTNDIADVN
PEECVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHALNVLVSSGADAQICVWNSDGWEK
QKSRFLQIPAGRNPAALSDTRVQFHQDQIHFLVVHETQLAIYETTKLECLKQWVPRESSA
PISHATLSCDSQLVYASFLDATVCIFGAANLRLRCRINPTAYLPANVSASIHPLVIAAHP
QEPNQFALGLTDGGVHVFEPLESEGKWGVPPPVENGSGSGMPSAPAVGTSGSDQPQR
Download sequence
Identical sequences A0A2G5DFF7
Aquca_020_00014.1|PACid:22025332 Aquca_020_00014.2|PACid:22025333 Aquca_020_00014.3|PACid:22025334 Aquca_020_00014.4|PACid:22025335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]