SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00023.1|PACid:22025062 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00023.1|PACid:22025062
Domain Number 1 Region: 26-294
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-41
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 1133-1392,1438-1475,1526-1558
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.9e-33
Family WD40-repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 502-630,668-828
Classification Level Classification E-value
Superfamily ARM repeat 2.12e-31
Family HEAT repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00023.1|PACid:22025062
Sequence length 1558
Sequence
MGNKIARTTQASASEYYLHDLPSSYNLVLKEVLGRGRFLKSIQCKHDEGLVLVKVYFKRG
DSIDLKEYERRLFQIREIFRSLQSPHVWPFQYWLETDKAAYLLRQYVFNNLHDRLSTRPF
LNLIEKKWLAFQLLYAVKQSHENGVCHGDIKCENVLVTSWNWLYLADFASFKPTYIPHDD
PSDFSFFFDTGGRRRCYLAPERFYEHGSEMLVGPDAPLSPSMDIFSVGCVIAELFLEGQP
LFELSQLLAYRRGQYDPSQILEKIPDAEIRKMILHMIQLDPESRLSAESYLQGYETIVFP
CYFSPFLHNFFSCLIPLDSDTRVAVVQSAFHDLHKKMMNKSNEEISNVACASSNIINSEP
CQQLENATQNLDPQSGCFRRGELDKGSANHQFQLLGDITTLLEDLEESKTCSKTKAMVEN
VPSATFGSICAKSSSPPNSRHSSKQSTGEFLKTIMKEFKGREHEVLGKIIQRDLDSLIIN
YDSQLDTSRIPCLDVPEHNMSCEGMVLIASLLCSCIRSVKLPQLRRSAVLLLKFCSFCIN
DEDRLQRVLPYVIAMLSDPAAIVRCAALETLCEILPLVRDFPPSDAKIFPEYILPMLSML
PDDPEESVRICYASNISKLALTAYRFLIQSQSLTEMGVLDKLSLKQKSSAPSVDISGQLH
SENSDVQLSDLRKAIAEVVQEVVMGPKQTPNIRRALLQDIGNLCCFFGQKQSNDFLLPIL
PAFLNDRDEQLRAVFFGKIVFVCFFVGQRSVEEYLLPYIEQALSDTTEAVIVNTLECLAM
LCKSSFLRKRILLDMIERSFPLLCYPSQWVRRFAVTFIAASSENLGAVDSYVYLAPVIRP
FVCRQPASLASEKSLLSCLKPPVSRQMFYQVLENARSSDMLERQRKIWYNSSMQSTQQEA
MDMSKRGMGELSPMLSRPGRQPASQDYKSASSSMQQPGLVEGAEVELRPMGSFIRNSSSA
MDIRDTLSSEKLQFSGFISPHVSGGTNFDCDGASEGIPVYSFSVDKRAVGATSAGSDSLS
LGGSVGTSSSSMLWMDQSNKSFNLASSAPKFVPGSFSISNGSKQLYKVKQDIEGRENSQI
ASIGSKFQDMGISGSRKGTSTITIDVPSPTDIAGVPSFVRPSSVTDTGWRPRGVLVAHLQ
EHQSAVNDIAISNDHCFFVSASNDSTVKVWDTRKLEKDISFRSRLTYPLHGSQALCTAML
RGSAQIVVGASDGAIHTFSVDYISRGLGNVVEKYSGVADIKKREIGEGSILNLLNYSTDG
SLSQMVMYSTQSCGIHLWDTRADSTSWTLRAVPEEGYVSSLVTGPCGNWFVSGTSRGVLT
LWDLRFLVPVNSWKYSQVCPIEKMCLFIPSSNTSLSVSGRPLVYVAAGCNEVSLWNAENG
SCHQVLRLANNDSDADKSDLPWALARPSSKSNSRHDLSRNVSQKYRVEELNEPPPRVPGI
RSFLPLPGGDLLTGGTDLRIRRWDHSSPGRSYSVCGPSLKGTRNEEFYETKSSYGVQVVQ
ESNRRPQTTKLTGKALLTAAASDSAGSHRDCILSLASVKLNQRLLISSSRDGAINVWK
Download sequence
Identical sequences A0A2G5DFI0
Aquca_020_00023.1|PACid:22025062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]