SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00403.1|PACid:22025811 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00403.1|PACid:22025811
Domain Number 1 Region: 677-963
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-71
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 32-367
Classification Level Classification E-value
Superfamily L domain-like 6.29e-56
Family Polygalacturonase inhibiting protein PGIP 0.0053
Further Details:      
 
Domain Number 3 Region: 282-589
Classification Level Classification E-value
Superfamily RNI-like 5.57e-50
Family Cyclin A/CDK2-associated p19, Skp2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00403.1|PACid:22025811
Sequence length 1011
Sequence
MSISHLFFFLLLSSLFQTNSQEQLELNILQTLKHHWNNPSSLESWTPSTPICTDWIGITC
KNGSVTEINLSNMNITHEISPSICDLTSLTRIDLSFNYIPGEFPYLLYNCSNLYSLDLSQ
NYFVGSLPSDIHRLSSSLQHLNLSSNNFSGDIPLSIGQLHSLRTLYLFSNQFNGSFPPSI
GDLSKLERLGLAYNEFRPSRIPLTFGQLKNLKFLWMTQANLIGEIPESIGSLVNLEQLDL
SINELSGKIPDSLFMLKNLTNMYLYANRLSGEIPRSVETLYLTGVDLSINNLTGTIPQDF
GKLQYLTTFYMYSNRLTGEIPASLGLLPYLTRIRLFRNRLTGVLPPELGLHSKLEFIEVS
ENSLIGKLPDNLCAGGVLIGLVVFSNNLSGEFPRSLAKCHSLTSIQVHRNNFSGEIPAGV
WSLKDLSSIMIRENSFSGELPDELAWNLTRLEISNNMFSGKIPSRIKSSLNLMVFDASNN
LFSGEIPKELTALPRLLSLSLDRNRLSGHLPLEIISWKSLNSLNLSSNQISGIIPPAVAQ
LPDLLRLDLSDNQLSGVIPPEIGHMKLSFFNLSSNHFTGKIPLEFENLAYDRSFLNNPGL
CSDLLNLSSCTPKAKAKSQKLSSPLLATSVVLAGVVLIVVLICSFVIRYGSKKKREQLLS
TWKLTSFQKLHFTESDILYSLSEDKMIGSGGSGKVYLIALNQSEFLAVKKIWNKGKLDEL
LEKEFQAEVQILGTIRHSNIVKLFCCISCDSSMLLVYEYMVNSSLDRWLHRRKRESMLSS
SVHRVFLDWPTRLHVAVGAAQGLCYMHHGCSQAIIHRDVKSSNILLDSNFNAKIADFGLA
KMLVKHGEADTMSAVAGSYGYIAPEYAYTTKVNEKIDVYSFGVVLLELTTGREPNDGDEH
TSLAEWAWRHFQEDHPLVDALDEEVKEPCYLEDMNVIFRLGLICTGTLPSTRPSMKEVLQ
VLLRCQSQQLYRETNVENEYNVHPLLSFKDMDSDSKRSLKCDDDDSFVCNM
Download sequence
Identical sequences A0A2G5DHE7
Aquca_020_00403.1|PACid:22025811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]