SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00421.2|PACid:22025004 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00421.2|PACid:22025004
Domain Number 1 Region: 124-176
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000602
Family F-box domain 0.0081
Further Details:      
 
Weak hits

Sequence:  Aquca_020_00421.2|PACid:22025004
Domain Number - Region: 313-479
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00353
Family Galactose oxidase, central domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00421.2|PACid:22025004
Sequence length 547
Sequence
MRRHKNLKIRALEDRRKQNFITTKTNPDYKQKKKVTQEYVNRSKYPIERLFNNGFQPKFY
EEYDNFCNPICYEDCEEIFDSFNYVDSSYSESFFDDEDCEDEENLQGFEDVDIEALEEEG
DETSGVMLKLPLDIFLDILSRQPIRSLARCRCVCKTWRKIVHHPRFTSMHIDKAIQLNSN
YDCNSSVSLVLHSTIYEAAFGNDIYCLEHDMGDNPDNAMIVKPRFAPSNFEFQVVGSCNG
LLCLSENLYYDPIYVCNPAIGEYVKIPEISKRTHYDIVSGFGYDEVAKEYKVIRMMFDSI
DYVSEGNSSFKLEAEIYTLGSGVWRKMGDVSYPLRGRASSAFVNGALHWLTDEFIGLSVS
ERIISFDVSREEFHAIPPPPGFDYVSETFHFSLCDLRKSLCLLDYSSNDQFEIWVMKKYG
VKTSWTKEYIISRQELGMDKFYLDPLKLLPNGEMLLVYNSESLVCYDPEQRTVRELGIHN
LPPRFEAFTHVGSFVSLSDIIGPSTSRRSVNNRKWYRALRPLYSQLSLVDPISFFPCNNK
IVFDLNY
Download sequence
Identical sequences A0A2G5DHH0
Aquca_020_00421.2|PACid:22025004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]