SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00445.1|PACid:22024813 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00445.1|PACid:22024813
Domain Number 1 Region: 254-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.05e-16
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 46-184
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000565
Family BTB/POZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00445.1|PACid:22024813
Sequence length 587
Sequence
MDSRTTVVSDSNDNNSGSSSISNETLSPEISAPDIAALKRLSENLESIFESPNSDFYSDA
KIIVSGSCDIPIHRCILSSRSSYFKTLFSSCSSNSSKREKHFKFDLKELMKDFNVGYDSV
VLVLGYLYGGKVKTLSRNVCVCVDDDCEHLGCKPAVDSMVEVLYASFVFQIPELIALYQR
RLLDILDKVSVDDILMILSVAKICSKACERLLLECIEIVVKSDIDIITLEKALPHDILKQ
VMESRSELAIGDPECNTFPNKHVKRIHRALDSDDVELVRWLLKEGHTTLDDAYALHYAVA
YCDAKTTTEVLDLGLADVNHRNARGYTVLHVAAMRKEPNIIVSLLTKGARPSDLTSDGKK
ALQISKRLTRSIDYNRSTEEGKSSPKDRLCIEILEQAERRDPLLGEASASLAMAGDDLRM
KLLYLENRVGLAKLLFPMEAKVAMDIAQVDGTQEFPFAANSRRSSGGQLTPMDLNESPFK
IEEEHLNRLKALSKTVELGKRFFPRCSDVLNKIMDADDLSQLAYLGNDTPEERIVKKRRY
VELQDVLVKAFSEDKEELDKSVALSSPSSSSSLALLRSKNMLNSDMK
Download sequence
Identical sequences A0A2G5DHK1
Aquca_020_00445.1|PACid:22024813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]