SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_020_00445.2|PACid:22024814 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_020_00445.2|PACid:22024814
Domain Number 1 Region: 254-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-16
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 46-184
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000392
Family BTB/POZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_020_00445.2|PACid:22024814
Sequence length 484
Sequence
MDSRTTVVSDSNDNNSGSSSISNETLSPEISAPDIAALKRLSENLESIFESPNSDFYSDA
KIIVSGSCDIPIHRCILSSRSSYFKTLFSSCSSNSSKREKHFKFDLKELMKDFNVGYDSV
VLVLGYLYGGKVKTLSRNVCVCVDDDCEHLGCKPAVDSMVEVLYASFVFQIPELIALYQR
RLLDILDKVSVDDILMILSVAKICSKACERLLLECIEIVVKSDIDIITLEKALPHDILKQ
VMESRSELAIGDPECNTFPNKHVKRIHRALDSDDVELVRWLLKEGHTTLDDAYALHYAVA
YCDAKTTTEVLDLGLADVNHRNARGYTVLHVAAMRKEPNIIVSLLTKGARPSDLTSDGKK
ALQISKRLTRSIDYNRSTEEGKSSPKDRLCIEILEQAERRDPLLGEASASLAMAGDDLRM
KLLYLENRDWLSCVWSGKTSISHGSESCNGHCPSGWYSGIPICCKFQKVKWWAVNTDGFE
RVTF
Download sequence
Identical sequences A0A2G5DHQ0
Aquca_020_00445.2|PACid:22024814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]