SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_021_00108.3|PACid:22039418 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_021_00108.3|PACid:22039418
Domain Number 1 Region: 11-286,320-369
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.42e-46
Family WD40-repeat 0.000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_021_00108.3|PACid:22039418
Sequence length 374
Sequence
MAATAVHQLAQCITCHAWSPDQTMVAICPNSNEVHIYKSSPDKWEQVHVLQKHDQIISGI
DWSTGSNKIVTVSHDRNSYVWNQEASEWVPTLVILRLNRAALCVQWSPKENKFAVGSGAK
TVCICYYEQENNWWVSKLIRKRHNSSVTGVAWHPDNILLATTSTDGKCRIFSTFIKGVDS
RDAGTTSSSELKFGEQIVQLDLSFSWAFGVRWSPSGNTLAYVGHNSMIYFVDDVGPSPSA
QSVAFSDLPLRDVLFVSERMVIGVGFDCSPMVFTADERGIWNFVKLLDQRKLVPSSANYG
SQLSGAFGKLYGQSKHISNDTVEPSRSRAGVHSNLITSILPLKVVGGAVKRFSTSGLDGK
VVVWDLENQSEFSL
Download sequence
Identical sequences A0A2G5DEU8
Aquca_021_00108.1|PACid:22039420 Aquca_021_00108.2|PACid:22039419 Aquca_021_00108.3|PACid:22039418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]