SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_022_00331.1|PACid:22055045 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_022_00331.1|PACid:22055045
Domain Number 1 Region: 225-265,313-529,643-681
Classification Level Classification E-value
Superfamily WD40 repeat-like 4e-57
Family WD40-repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_022_00331.1|PACid:22055045
Sequence length 690
Sequence
MRKSNDGDDLFYDSVDSFRSCDSLSPKNSPSQTVELDYRIWKSEPVSVLERRNRFLQGMG
LNEFVPPQMSHSEEIILDKISFESSPKNLELERIAESSRAVTRSSSSSSNRGEGEASCSG
RDVNGETKWSTDGRTTCESDQAIRLLPNAQQFSTREATAHGEEHIGELNASKKRIKSWWN
RIVQKRMKEGVQKKDGSIGECKAPNSNRMNVRHNAKKCLEFSAVYMQQHIQAHKGFIWTM
KFSPDGQYLASGGEDGVVRIWHVTSTDASSKNLTAKDASKLIHKARRRKLLPGKKKSKPA
SVVIPQKAFKVDESPLHEFYGHTDDVLDLCWSKSNCLLSSSKDETVRLWQVGSDECLQVF
PHNNYVTCIQFNPTDDGYFISGSIDGKVRIWGLSECRVVDWADVRDIITAICYQPDGQGF
VVGSISGHCRFYDASGNNLQLDAQISVQGRKKSSNNRITGFQFSPEDAQKVMITSADSKV
RIFDGLDVVHKYRGLRKSGSQMSASFTSNGKHIVSVGEDSRVYMWNYDGSCAASSKQAKS
TNSCEHFFLEGVSVATPWLGMEHELMDSTLESSSPTVDPVVSSSLLRDSARFSLGGWFSM
DGRLRGLATWPEEKLPLWSVPVEENDHSHQNHNDHDKQDRDHPHHQDHHQKHYPHKNRAA
LSSTWGLVIVTGGYDGVIRTFHNYGLPVRL
Download sequence
Identical sequences A0A2G5DE76
Aquca_022_00331.1|PACid:22055045 Aquca_022_00331.2|PACid:22055046 Aquca_022_00331.3|PACid:22055044 Aquca_022_00331.4|PACid:22055047 Aquca_022_00331.5|PACid:22055048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]