SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_022_00350.2|PACid:22054604 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_022_00350.2|PACid:22054604
Domain Number 1 Region: 228-618
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.46e-93
Family Regulator of chromosome condensation RCC1 0.0011
Further Details:      
 
Domain Number 2 Region: 11-116
Classification Level Classification E-value
Superfamily PH domain-like 3.5e-24
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 3 Region: 617-688
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.6e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_022_00350.2|PACid:22054604
Sequence length 1126
Sequence
MSLSDPSLSALIALKKGSQLLKYGRKGKPKFYPFRLSNDESSLIWFSSGGERTLKLAAVS
KLIPGQRTSVFRRYLRPEKDYLSFSLIYNNGKRSLDLICKDKVEAEVWIVGLKALISSGQ
HGRSKIDGWNDGGLDQDDSRDLTSNSPSDSSATTRDISSPETSVSFSTSTFPKSYTSESV
VGSERSHVVVDPTNMQQKGSSSDVFRVSVSSAPSTSSHGSAQDDCDALGDVYIWGEVICD
NVARVGSDKNINPLSPRPDVLLPKPLESNVVLDVHHVACGVRHAALVTRQGEVFTWGEES
GGRLGHGVGRDVIQPRLVESLALSSVDFVSCGEFHTCAITMAGEFYTWGDGTHNAGLLGH
GSDISHWIPKRVSGPLDGLQIASVTCGPWHTALITSTGQLFTFGDGTFGVLGHGNRESVL
YPREVESLMGLRTIAVACGVWHTAAVVEVIVAQSSASISSGKLFTWGDGDKSRLGHGDKE
PRLKPTCVPALIDYNFHKIACGHSLTVGLTTSGHVFTMGSTVYGQLGNPNSDGKLPCLVE
GSLMGECVDEIACGAYHVAVLTSRNEVYTWGKGANGRLGHGDIEDRKTPALVEALKDRHV
KFIACGANFSAAVCLHKWVSGAEQSQCSACRQAFGFTRKRHNCYNCGLVHCHGCSSRKAF
RAALAPNPGKPYRVCDSCHVKLSKVSEANGNNKRRNVMPRLSGENKDRLDKSDLRLSKST
LPTNLDLIKQLDNKAAKGKKADTFALVRSSQPLSFQLKDMSFSSAVDTRRTVPRPVLTSV
GQSGINSRAVSPFSRKPSPPRSATPFPTTAGLSFSQGITDSLKKTNELLNQEVQKLRSEV
ESLRQRCELQEFELQNSAKQVQEAMALATEESAKSKAAKEVIKSLTAQLKDMAEKLAPGV
YDGDSMRPVYLPNGLEPNSIFHPDVNGEHVRNDASNGAHLTSLLGNDSTEIGIFGQTPLH
REAPGTNGTIAHFQNNGFSASNGKGLHTDMGLQDSNGGTHMGTSSSRSQADNSAEPEPLQ
NGESGVKSKSSSVAGNSNQVDAEWIEQYEPGVYITLVALHDGTRDLKRVRFSRRRFGEHQ
AETWWSENREKVYEKYNVRGSDKSSSGASGQSALRTEGALSPSSQR
Download sequence
Identical sequences A0A2G5DF63
Aquca_022_00350.2|PACid:22054604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]