SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_023_00056.3|PACid:22023216 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_023_00056.3|PACid:22023216
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-40
Family Voltage-gated potassium channels 0.0031
Further Details:      
 
Domain Number 2 Region: 241-434
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-40
Family cAMP-binding domain 0.0087
Further Details:      
 
Domain Number 3 Region: 428-623
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-35
Family Ankyrin repeat 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_023_00056.3|PACid:22023216
Sequence length 745
Sequence
MVLLVAYSAWVYPFEIAFMKSSPGGGLHIADSIVDLFFAVDIVLTFFVAYIDPRTQLLIR
DPRKIAVRYLSTWFVMDLASTIPFEALGFLFTGKTKMGLPYCLLDMLRFWRLRKVKQLFT
RLEKDIRFSYFLVRSARLLSVTLFLVHCAGCLYYLLADRYPQQGKTWIGSVIPNFRESSL
WIRYISAIYWSITTMTTVGYGDLHAVNTREMIFNIFYMLFNLGLTAYLIGNMTNLVVEGT
RRTMEFRNSIQAASNFVTRNHLPPRLKEQILTYMCLRFRAETLNQHQLIEQLPKSICKSI
CRHLFLPTVEKIYLFNGVSEEILLLLVAKMKAEYIPPREDVIMQNESPEDVYIVVSGEVE
IIHGDIENEQIVGKLISGDIFGEVGGLCCRPQTFTFRTKTLSQLLRLKTSDLIEAMQTRQ
EDNIVILKNFLQHYRELKDLRIADLFVDNGEDGDNYNISFNLLTVASTGNAAFLDELLKA
RLDPDVGDSKGRTPLHIAASKGHEECALVLLKHACNINIQDKDGNTPLWDAISGKHHSIF
RILYHCAAISDPYIAGDLLCLAAKRNDLVIMKELLKHGLNIDSKNRQQLTALQIATAENH
IDMVNLLVMNGANTEEVNWNGFSSEIIDKMVQQREVGHRITVHENIPNGTEKIIYRNKEE
KKCRKGECCLRVSIYRGHPALRKKTGCNEAGRLIRLPTSMQHLKLIAGEKLGCNTRYAII
TNEEGAEIDSIEVIRDNDKLYIVEN
Download sequence
Identical sequences A0A2G5DC00
Aquca_023_00056.3|PACid:22023216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]