SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_024_00125.3|PACid:22051373 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_024_00125.3|PACid:22051373
Domain Number 1 Region: 282-597
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 5.23e-40
Family Galactose oxidase, central domain 0.015
Further Details:      
 
Domain Number 2 Region: 34-149
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.66e-19
Family Flavin-binding PAS domain 0.0018
Further Details:      
 
Domain Number 3 Region: 191-261
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000379
Family F-box domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_024_00125.3|PACid:22051373
Sequence length 616
Sequence
MEWDSDSDGIISGDEEGGFLLSDGGPFPFAIRSLIQTSPCGFVVTDALEPDLPIIYCNAG
FELVTGYSAEEIIGRNCRFLQCRGPFAKRRHPLVDSTVVSEIRKCLNAGVEFQGDLLNFR
KDGSPLMNSLRLTPIYGDENIITHIIGIQFFTEANLDLGPLPGYLVKESARSADRFHSDL
SFYRPNPAGHGNACFEHCAIFQLSDEVLSHKILSQLTPRDIASVGSVCKRLYQLTKDEDL
WRMVCQNEWGSETTRVLEAVPGAKRLGWGRLARELTTLEAAAWRKLTVAGAVEPSRCNFS
ACAVGNRVVLFGGEGVNMQPMNDTFVLDLNASNPEWRNVKVSSPPPGRWGHTLSCVNGSS
LVVFGGCGRQGLLNDVFVLDLDAQYPTWREISGLAPPLPRSWHSSCTLDGTKLVVSGGCA
DSGVLLSDTFLLDLTMEKPIWTEIPVAWSPPSRLGHTLTVYGGRKILMFGGLAKSGPLRL
RSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPAGVAPPPRLDHVAVSLPGGRILIFGGSVA
GLHSASQLYLLDPTDEKPTWRILNVPGHPPRFAWGHSTCVVGGTRAIVLGGQTGEEWMLS
ELHELSLTALLCDSDV
Download sequence
Identical sequences A0A2G5DBF3
Aquca_024_00125.1|PACid:22051375 Aquca_024_00125.2|PACid:22051374 Aquca_024_00125.3|PACid:22051373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]