SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_025_00164.4|PACid:22063562 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_025_00164.4|PACid:22063562
Domain Number 1 Region: 69-146
Classification Level Classification E-value
Superfamily F-box domain 3.66e-20
Family F-box domain 0.0033
Further Details:      
 
Weak hits

Sequence:  Aquca_025_00164.4|PACid:22063562
Domain Number - Region: 225-261
Classification Level Classification E-value
Superfamily Lysozyme-like 0.0302
Family C-type lysozyme 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_025_00164.4|PACid:22063562
Sequence length 318
Sequence
MTVSEDEDETLANFLESEILSEVSDQEEMKTDLPPLKKKVRFNDDNDDDEAKSSSSGCRT
IISMDKNVPRLIDTGLFSKIPPELFHHILKFLSSEDLIACSMVCRFLNHVASDECLWHRL
YCMRWGVASPTKKLREFTWKELYIQRDEEDMVQFVRNTPSEFKEYYIQMQVAKRSQTPLP
SQVNDDSIILDKTVADQISMWRVSRGLTDEVVADHACSGHTCTYYQIGNVYLCEKTGRVH
VCGDTCREVVMDTFTGLWVCTVSGHCFDTLLSPAETEPDAEQQGVTDEAEPFMGSGRFGK
ASNQCLYFCVIVMYECLV
Download sequence
Identical sequences A0A2G5D9S2
Aquca_025_00164.4|PACid:22063562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]