SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_025_00164.6|PACid:22063564 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_025_00164.6|PACid:22063564
Domain Number 1 Region: 65-142
Classification Level Classification E-value
Superfamily F-box domain 3.66e-20
Family F-box domain 0.0033
Further Details:      
 
Weak hits

Sequence:  Aquca_025_00164.6|PACid:22063564
Domain Number - Region: 221-257
Classification Level Classification E-value
Superfamily Lysozyme-like 0.0295
Family C-type lysozyme 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_025_00164.6|PACid:22063564
Sequence length 315
Sequence
MTVSEDEDETLANFLESEILSEEEMKTDLPPLKKKVRFNDDNDDDEAKSSSSGCRTIISM
DKNVPRLIDTGLFSKIPPELFHHILKFLSSEDLIACSMVCRFLNHVASDECLWHRLYCMR
WGVASPTKKLREFTWKELYIQRDEEDMVQFVRNTPSEFKEYYIQMQVAKRSQTPLPSQVN
DDSIILDKTVADQISMWRVSRGLTDEVVADHACSGHTCTYYQIGNVYLCEKTGRVHVCGD
TCREVVMDTFTGLWVCTVSGHCFDTLLSPAETEPDAQGVTDEAEPFMGSGRFARAYLLGY
DCVDEKELKAALRFC
Download sequence
Identical sequences A0A2G5D9U4
Aquca_025_00164.6|PACid:22063564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]