SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_025_00164.7|PACid:22063565 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_025_00164.7|PACid:22063565
Domain Number 1 Region: 69-146
Classification Level Classification E-value
Superfamily F-box domain 3.27e-20
Family F-box domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_025_00164.7|PACid:22063565
Sequence length 296
Sequence
MTVSEDEDETLANFLESEILSEVSDQEEMKTDLPPLKKKVRFNDDNDDDEAKSSSSGCRT
IISMDKNVPRLIDTGLFSKIPPELFHHILKFLSSEDLIACSMVCRFLNHVASDECLWHRL
YCMRWGVASPTKKLREFTWKELYIQRDEEDMVQFVRNTPSEFKEYYIQMQVAKRSQTPLP
SQVNDDSIILDKTVADQISMWRVSRGLTDEVVADHACSGHTCTYYQIGNVYLCEKTGRVH
GLRFCVNVVSLQYVVIHAGKLSWILLRVFGCVQFLATVLIHCSHLQKQSQMPNSKG
Download sequence
Identical sequences A0A2G5D9T6
Aquca_025_00164.7|PACid:22063565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]