SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00090.3|PACid:22056261 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00090.3|PACid:22056261
Domain Number 1 Region: 11-59,92-120
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000283
Family WD40-repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00090.3|PACid:22056261
Sequence length 657
Sequence
MKFGGFVLVQVVIKDFVSRAVISQFRAHTSPISALSFDPSGTLLVTASVYGNNINIFRIM
PSCIQNGSGISNYDWSSSHVHLYKLYRGITTAVIQDICFSHFSQWVAIVSAKGTCHIFVL
SPFGGDTSIQTPIVHSNTSTLLHGLSSPWWSTTSLMVNQQSCLPPPPVTLSVISRIKNGN
SGWRSVSNAISTGKASTPSGVVAVAFHNCIAQSLQSATSKANALEHLLVYTPCGHLVQHE
FLPSLGVEPNDNVSRTASSSLVQAQDEESRVKVEPVQWWYVCRRSDWPEREECVSGNTHE
RQGGDIMMEYSDCEDNGNKYLMEFNNSVGGNGFVKSHERPHWYLSNAEVQISSGRIPIWQ
KSKISFHVMISLMANGRTISNDFNDGECEIEKVPVHEVEVKRKDLLPVFDHFHSIKADWD
DRVFVGGRYSNSSCYGSNRTKDKFKEETLSCHSKPASVSSVEGSDAGYSRTSERFLDLDS
VKCYARPVHSMNETGHGKRDCAALSSGPLGQCTERDRGSSVLLHFNGDNSQGETSCVTHV
VSSPMGNTVSAVDSIADKALSKSSGNSDRPNASTGGPPSSLNTVTEVLEHVDSHDPLDFG
QYFQEGYCKASELDGSRDLTEVADADSSSSHCEKEKPEDDEECDDMLGGVFAFSEEG
Download sequence
Identical sequences A0A2G5D7A6
Aquca_026_00090.3|PACid:22056261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]