SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00108.1|PACid:22055902 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00108.1|PACid:22055902
Domain Number 1 Region: 44-333
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-55
Family WD40-repeat 0.0002
Further Details:      
 
Weak hits

Sequence:  Aquca_026_00108.1|PACid:22055902
Domain Number - Region: 394-479
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 0.0288
Family Arp2/3 complex 16 kDa subunit ARPC5 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00108.1|PACid:22055902
Sequence length 530
Sequence
MAENQIGKTFPVKSRLKPTSKKTSSSPESRYWRTFKTTEIPKLIYPITSIDFSPISPYDF
ASTYSASVTLYNSQTFEPKSTFSSFKDIAYSACFRCDGKLLAAGGETGLVQVFDIKTRSA
LRRLHGHNRPVRVVKYPGLDKLHLFSGGDDSLVKFWDIATETQLLNFQGHKDYVRSGSAS
PASSDLFATGSYDHTVKVWDSRGGASMKYVMEFNHGKPVEDVVFLPSGGLIATAGGNYVK
IWDVIGGGKLVYTMESHNKTVTKMCVGKVKRDGSENSDQYRLFSVALDGYMKVFDYSALK
LTHSMRFPAPLLSIGFSPDFSTRVIGTSNGIMYAGKKKKKVVDVDAVVGVGDLVGFTSVP
EPEKRVLRPSNFRYFRRGQSEKPSMLDHVIERPRKPKLAMHDKLLKSFRHKEALVTALTA
GNPKYIMAVMEELVARRKLLKCVSNLGKDELELLLKFLHKYTTMPSYSGFLIGFTKKVLQ
MRAEDVNASDILQGHVRHLKRSVEEEINIQQSLQEIQGIISPLLRIAGRR
Download sequence
Identical sequences A0A2G5D883
Aquca_026_00108.1|PACid:22055902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]