SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_026_00190.1|PACid:22055946 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_026_00190.1|PACid:22055946
Domain Number 1 Region: 4-168,196-315
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-74
Family WD40-repeat 0.0000503
Further Details:      
 
Domain Number 2 Region: 238-309,336-548
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.000000000000497
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_026_00190.1|PACid:22055946
Sequence length 1219
Sequence
MLTKFETKSNRVKGLSFHNKRPWILASLHTGVIQLWDYRVGTLIDKFDEHEGPVRGVSFH
YSQPLFVSGGDDYLIKVWNYKLRRCLFTLHGHLDYIRTVQFHHESPWILSASDDQTIRIW
NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTIRVWDIGALRKKGVSPADDSMR
LSEMNSDLFGGVDAVVKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQIKLWRMNDTKAWE
VDTLRGHGNNVSCVMFHAKQDIIVSNSEDKSIRVWDVTKRIGIQTFRREHDRFWVLAFHP
EMNLLAAGHDSGMIVFKLERERPAFSVSGDSLYYVKDRFLRIHDFYTQKDSQVIPIRRPG
SLILNQGPRTLSFSPTENAVLLSSDVDGGCYELYILPKDSTGRGDALQDVMRGLGGSAVF
VARNRFAVLDKINNHVIVKNLKNDIVKKSSLPFAADAIFYAGTGNLLCRSEDRVIIFDLQ
QRIVLCDLQIPFIKYVAWSSDMESVALLGKHVIIVANKKLEHQFTVHETIRVKSGAWDDN
GVFIYTTLNHMKYCLPNGDSGIIRTLDVPLYITKVSRNIVCCLDRNVKNCPISVDPTEYM
FKLSLLKKKYDRIMSMIKNSQLFGQAIIAYLQQKGYPEVALHLVKDERTRFNLALECGNI
QTAVASANELDEKDHWYRLGVEALRQGNASIVEYAYQKTKNFERLSFLYLITGNIEKLSK
MMKIAEIKNDVMGQFHNSLYLGDIHERVRVLEKAGHLPLAYITASVHGLKEDADRLGKEL
GDNIPSLPKGKVPSLLIPPAPVLSCSDWPLLRVMKGIFEGGLDNIGKAGENEEDDEALDA
DWVEDLDIDDVIGMQNGNVEILVENSDAIEGNDEEGGWDLEDLELPPEVATPKASINGRS
VGFIAPTLGMPVSQIWIRDSSLPAEHAAAGNFDTALRLLTRQLGIKNFIPLKPMFLDLYL
GSQSYLRTFDSAPVISLEIEKGSSETSGGSVPHAPALVFNFSRLDEKLKTAYKATTDGKF
AEALRLFLNILQSIPLTVVYSRREVDEVKEMILLAKEYVIGLKMEVMRKEVKDDMIRQQE
LAAYFTHCNLQTVHLRLALMNAMTICFKAGNYMTAANFSRRLLESNPPKEIQAKKARQVL
QACERNMKDTTELNYDFRNPFVVCGATYVPIYRGQKGVSCPYCGSRFVPSIEGKLCTVCD
LAVVGADTSGLRCSPSQVR
Download sequence
Identical sequences A0A2G5D7S8
Aquca_026_00190.1|PACid:22055946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]