SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_027_00288.1|PACid:22045392 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_027_00288.1|PACid:22045392
Domain Number 1 Region: 77-350,381-433
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000485
Family WD40-repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_027_00288.1|PACid:22045392
Sequence length 1337
Sequence
MKNLKVYSELTSQIEELKIKDEVILFSAFDIERNRLFFSSSANIIYTIQLPLSHEKERAY
GETPLHVEVEPMDLEPGDCVTAMDYVMEKEALLVGTLSGYLLLYIKEDNMTEVVGRVDGG
VKSISPSPDGAVLAVITGFGQLLVMTHDWEVLYETALEDTSKDIDAAVAGEPTGHLFESP
ISWRGDGKYFATLTEVDKSSLQKRIKIWERESGALHASSESKAFSGAALDWMSSGAKLAA
SCASKADKKNPSITFFERNGLERSSFIVDGPMDGIVETLKWNCNSDLLAAIVRYEGYDTI
KIWTFSNNHWYLKQEMRFLKKDGVKFMWDPTKSLHLICWTIGGKITTYNFVWVMAVMENS
TAFVIDNSNILVSPLALCLMPPPMCLFSLKFSSAIQDIALLTKNSKNLLAACLSDGSLCV
AELPDDDTWEELEGKEISIEAVYSEIKFWSFRHLIWLDPHILLGVSYQELGNPKYSLSTS
LNENELSPQRGMNKSLGFFLQEIEIVCSEGRVAGLVTSSGWSAKISNQQSFERPVIAVAP
NPGKGCSAFVQTDGGRILEYTPKLRLTEGLAEHCIRKRDYDVGFSSSCPWMNVVSINDNG
VSKPLLLGLDSNSRLHVNGRILCNNCSSLSFYSNSTDHMMTHLILTTKQDLLFIVDIEDI
FHDDLDTKYGNFVRGTNKNKENKDSINIWERGAKLVGVIHGDEAAAILQTNRGNLECIYP
RKLVLQSIVNALVQGRFKDALHMVRRHRIDFNVIVDHCGWNAFLRSAKEFVGQVNNLSYI
TEFVCSIKNENVMETLYKNVVTPPCMKDSTGIQDFEDSDVKGKVSSVLMAIRKALEEDVE
ESPARELCILTTLARSEPPALEEALMRIKVIRDMELLAVHDPRRKVYPSAEEALKHLLWL
SDSDAVYDTALGLYDLNLAAIVALNSQKDPKEFLPFLQGLEHMPPVIMQYTIDLRLQRYE
SALKHLALGGDAYYEDCMNLMKSNPQLFPLGLQLFTVPAKRSELLEAWGDHLYCEKCFED
AAATYMCCSSLQKALKSYRDCGNWKGVLTMAGHLKMEKKEVLQLANELCEELQALGKPGE
AAKVALEYIGDIANGVRCFICAREWEEALRVGLMHERDDLISEVKNAALECASTLMGEYQ
DGLEKMGKYLTRYLAVRQRRLVLAAKLRAEDRLLSDVNDDLASETSSCFSGMSAYTTGTR
KGSSASISSSATSKGREMRRQKKHKGGKIRAGSPGEEMALVEHLKGMSLTSAARCELKSL
LMTLLMLNSEEIARKLQHAGDRYQLSQMAAVKLAEDTMSSENIDENSHTLEHYIHKNRAE
LLSSEVFCWQSKVLLPP
Download sequence
Identical sequences A0A2G5D654
Aquca_027_00288.1|PACid:22045392 Aquca_027_00288.2|PACid:22045393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]