SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00016.1|PACid:22035943 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00016.1|PACid:22035943
Domain Number 1 Region: 676-999
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.52e-67
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 33-328
Classification Level Classification E-value
Superfamily L domain-like 3.74e-62
Family Polygalacturonase inhibiting protein PGIP 0.005
Further Details:      
 
Domain Number 3 Region: 265-603
Classification Level Classification E-value
Superfamily RNI-like 1.26e-57
Family 28-residue LRR 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00016.1|PACid:22035943
Sequence length 1009
Sequence
MMSSHFSFILLCCCICLAFIRLSKAQINLGGRNETDRLALLAFKDQITIDPLKVMSSWND
SHHYCEWEGVTCGLRHPRVTMLNLDSQGLVGSISPHIGNLSFLRLLNLQNNSFHGVIPRE
IGRLFRLEGISLINNSLVGEIPINISLCYSLTRLFLSGNNFVGKIPMELGSLPKLVSLAL
ENDNLTGEIPPSLGNITTLKNLALSYNNLEGVIPSTLYNLKSLEILSIHANTLSGMFPSS
LYNLSTLQVISISANQLTGNIPSETNLHNLQFFLIGGNRFSGHIPSSLFNASKLFRFDIS
GNQFTGKVPVNLGNLNELTFLALQENSLGSGKSGDFDFITPLTNCSNLETIVLYSNELGG
SLPVSVANFSKSLTSLYLSQNQITGNIPKELENLQNLILLDLSTNFFNGSIPIGLGNLRK
LQILGLQNNQLSGQVPLFLWNMSQLVELDLSNNILEGSIASALDNQNLQILDLSRNNFTG
PIPREIGLSSHLIRLVLRHNSLNGSIPLEVGNLKNLGYLDVSENNLTGEIPGVLSSLSLE
YIYMGSNFFQGPLPSSLADLEGLLSLDVSHNNLSGIIPRQLGKLSVLTTLNLSFNNFEGA
VPVEGVFRNSSAFSVFGNLKICGGPPNLRLPKCRIQRSKKQDNGLAVKVILGVLIPSLIV
GFCLIFLYFRKNPKGKPSSEEGFGDLKRVSYNDLYKATDGFSSTNLIGRGSYGSVYKGIL
QQDESPVAVKVLNLIERGASKTFMAECEALREVRHRNLLKILTVCSSVDFKGEGFKALVF
EFMPNGSLESWLHPSSDGQDVPRSLNLCQRLNIGIDVASGLEYLHNHCERPIAHCDLKSS
NILLSDDLTAHVGDFGLAKFLSAETRSTITSNKDESSSIAIRGTIGYIPPEYGAGGEVST
QGDIYSFGICLLEMFTRKRPTDQMFKDGHSLHEFSKLALPHRVMEIIDERLLSEETHNGD
INALNRMRECLSSIIRIGIACSVDIMTERMDIKDVLKELHSIKAIYLQV
Download sequence
Identical sequences A0A2G5D0V8
Aquca_030_00016.1|PACid:22035943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]