SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00087.1|PACid:22035578 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00087.1|PACid:22035578
Domain Number 1 Region: 1-372
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.3e-57
Family Phosphoglycerate kinase 0.0000201
Further Details:      
 
Domain Number 2 Region: 374-596
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000000000172
Family TrmB-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00087.1|PACid:22035578
Sequence length 602
Sequence
MVRLDFTLPNRQVLDSNISFNERSLLTIKYLYHAGAKVLVSSSWGCPKDTTQPPSAEIVA
DYLSSVLELKVMPTSWISDCAQSKEEDFDRADVLLIENLSTFREELANSSAFARKLSSGV
DVFVNDTFSQSHKILASTVGVTRYCYASVAGFAFEEELSRLVEITTTTKQPYIAIIGGDN
LKGKAAAIHFLASKCDGLVFVGMIAFQIMHGKGLPVPLRFVESGAVKDSLKIIDDAQRRK
IPILLPKDFVCVNDSLPKQLHTFPAQRILDGWKPVDLGPNSMIDISSMLSKCQKILCIGP
LKLKLPRADNCLASKLAAMLETSSRSGCDVIVIGTAACKEFSRPSGCTLFKNASVAWVCF
KGRVLPGLAALDRAYPFVIDWDTTFNNPAQPLVVDIGSGNGLFIFEMARRKKDMNFLGLE
ANKKVYISLVLCSLGLSSFLLNFFIVVQLVDLCLDSVHQPGLKNRYFIATNATSTFRSIV
SSYPGDLVLVLIQCPNPDFNKPEHRWRMLQRALVEAIVDLLTINGKVFLQSDVEKVAVRM
REEFIRYGKNKLAIIENEDDLELDDEGWLRDNPYGVRSDWEQHVINRGAPMYRLMFSRVN
ES
Download sequence
Identical sequences A0A2G5D160
Aquca_030_00087.1|PACid:22035578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]