SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00203.2|PACid:22035696 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00203.2|PACid:22035696
Domain Number 1 Region: 65-380
Classification Level Classification E-value
Superfamily L domain-like 2.62e-48
Family Polygalacturonase inhibiting protein PGIP 0.0023
Further Details:      
 
Domain Number 2 Region: 343-602
Classification Level Classification E-value
Superfamily RNI-like 1.73e-45
Family 28-residue LRR 0.022
Further Details:      
 
Domain Number 3 Region: 786-892
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000995
Family Protein kinases, catalytic subunit 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00203.2|PACid:22035696
Sequence length 906
Sequence
MLLYLLDLCKPLHPSQDILALLEFKKGIKHDPTSFILSSWNEESIDFNGCPSSWNGIVCD
AEGNVAAVVLYGLSISVDAELTLTVFSNLTHLVKLSVSKNLITGIIPNHIIPRYKTLQYL
DLSDNLFTGNLPTDIAHFPSLKNLSLAGNNFSGSIPDSISRLSSSLQTLDLSRNAFSGAL
PAALLHMNNLVSLNLSCNAFSGRIPPGFEQITSLEVLDLHQNELDGHLDFEFLLSSSVVH
VDFSGNFLSTYPSEKQQQKFLPRISETIKYLNLSNNRFTGTLVNGGELPMFESLKVLDLS
YNQLSGELPEFNFVYELETLRLGNNRFSGLIPNGLLKGDSLVLKELDLSSNNLSGTVSMI
TSTSLRVLNLSSNGISGELPLLVVDCVVLDLSRNQFTGNLSRVVKWGDSIEFLDLSQNQL
VGSIPESSSQFIRLSYLNLSHNSLSDSLPTVLTQYPKLKSLDISSNQLSGPLLTDLLTLP
TLQELRLENNILTGAIKFSPPSPNVPNLMVLDLSHNQFSGYFPAEFGSLTGLNVLDLAGN
NLSGSLPSSISGISSLTSLDISQNNFTGSLPENLPTSLQTFNVSYNDLSGPVPVNLQKFP
DLSFHPGNPGLQLPNAPTGGGSSPAGNSPRKPIKTVIKVVVIVTCVFAVIILILLAVFIH
YIRISRRSHRKNITSKDVHRLASSNPGAFTGRETGGPVVVSAEDLMAARKGSSSEILSPD
QKVAIVSGISPSKTSHISSSPDSGDSFNPENLSRLDVRSPDRLAGELHFLDDSITLTPEE
LSRAPAEVLGRSSHGTSYRATLDNGVLLTVKWLREGVAKQKKEFSKEAKKFANIRHPNVV
GLRGYYWGPTQHEKLILSDYISPGSLASFLYGNISFNLYLFWLFAYILCSCLYSFFELID
VGNVVW
Download sequence
Identical sequences A0A2G5D1R4
Aquca_030_00203.2|PACid:22035696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]