SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00345.1|PACid:22035690 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00345.1|PACid:22035690
Domain Number 1 Region: 33-69
Classification Level Classification E-value
Superfamily F-box domain 0.00000000458
Family F-box domain 0.0051
Further Details:      
 
Domain Number 2 Region: 85-119
Classification Level Classification E-value
Superfamily F-box domain 0.0000196
Family F-box domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00345.1|PACid:22035690
Sequence length 198
Sequence
MKLITSSNSKLGNQLRFGSYGGSREEKDGFRNDDIAIEVLSRLPIEFINKFKCVCKKWYE
LISHPSFRKGTKDGFTNDDIAIEVLPIESTIKFKCVCKKWCEVLSHPSFRTSHFQSAKVL
DFLPEKVVVMASCSGLLLCRNIFVVDHSSESMRTKSKPEPMEVVLYVCNPLTKEWTSLKA
GDKYENGWCYGFVHNPFY
Download sequence
Identical sequences A0A2G5D2M0
Aquca_030_00345.1|PACid:22035690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]