SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00359.2|PACid:22035700 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00359.2|PACid:22035700
Domain Number 1 Region: 466-695
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000015
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number 2 Region: 699-923
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000288
Family Tropomyosin 0.0015
Further Details:      
 
Weak hits

Sequence:  Aquca_030_00359.2|PACid:22035700
Domain Number - Region: 912-1000
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000314
Family Myosin rod fragments 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00359.2|PACid:22035700
Sequence length 1337
Sequence
MEEPTQAESEIQVTKADSIDSGITHSNEVGAGKDEILTNGSLEHEEVEIKGQEEETALEG
EFIKVEKEALDLKESSDKEQVQKPSVVERSSSNSLESRDLLEAQEETKELKLELQRVADE
MKNSERESTLLKEELLNTKEKLEESLKHCEELEVNQKQKEELILDHEEKYKSQINTLQEA
LEAQEAQHKELVDVKEAFTGLTTELENSRKKMQELELDLQSSVGEARKFEEQSHQIGSHA
ETETQRALEFERMLELAKGSAKEMQYQTASLQDELKDLYKKIAESQQVEESLRSTTAELS
AVQEQFELSKSLVSDLQKQVASEEDVKNALNQELDSHKASDMRVKDDILALENLLSSTKG
DFQVKVAELEDIKMKLHEEVETKKMVEDRLKSQEENISTLQEELAKVVSEKVSLEAVVVD
LNTNVLQMKELAGDLETKLKLSDENFSKADALLSEALSNNVELEHKLKSLDELHQEVGSV
AASTTQKNLELEDILQASSAAAEEAKSQLREIETKLISNEQKNLELEQQLNMVELKSSDT
ERELKEIIEKTSELNVKLIGLEEEKVLLQNEKHEYQEKLTQLETALSQSSSRNLELEQEL
KDVAEKCAKHEAHATTTNQRGLELEELVQISESKVKDAGNKVAELELLGETTNYRIKELE
EQISTLETKSNDKEEEHKHLSDKVSELAAQLEIFQGKASHLELELQAANEKDKELSESLN
LALEEKLKFEDMSNSSSKKLSETENLLGVLQNELKLAHEKLEGIEQDLKVSGIRESEIME
KIRSAEEQLEHQGRIIEQATTRNSELESLHESLLKDSEIKLQEATANFTNRDSEANSLYE
KLKMLEDQKRTYEEQVAEANERSGSLKAELNEISLKLVAQENIIEELKGKVEEANNKTGQ
SISDNELLAETNLQLKSKIDELQELLSSSLAEKEATSHQLTYHMDTLAELTDQHSRLTEI
HSATESRVREAEVQLQEAIEKFSQRDSEAKDLNEKLHALESEIRLYEETANEASATAQKQ
KSELEEAHLKVKHLDSVLQDLQSKASQIEKDNEELAVTNLRLTQELVAHESKVSAIIEEN
NTLNETYQIERKELQEVINKLEGQKNEQKESEDSLKAEAESLKAELAEKSVVGVHVVELK
QQLALLEARIKEEKESDLLKESEREVISKNSLEELESKCKQVLLLEKQVEELEQKLHLAD
AKSIETDEKAQELAVVLAELDDLRKRSSQTAELETKIEGLESQLKLANVSSQDQGNVGSP
GELNEVVEAKSRDIGLNVSTPSKRKSKRRSEATSAQTSSTSVIHSPTTEASSPLNFKFIF
GIALVSVIIGIILGKRY
Download sequence
Identical sequences A0A2G5D2P7
Aquca_030_00359.2|PACid:22035700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]