SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00359.3|PACid:22035701 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00359.3|PACid:22035701
Domain Number 1 Region: 461-695
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000719
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number 2 Region: 697-921
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000386
Family Tropomyosin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00359.3|PACid:22035701
Sequence length 1210
Sequence
MEEPTQAESEIQVTKADSIDSGITHSNEVGAGKDEILTNGSLEHEEVEIKGQEEETALEG
EFIKVEKEALDLKESSDKEQVQKPSVVERSSSNSLESRDLLEAQEETKELKLELQRVADE
MKNSERESTLLKEELLNTKEKLEESLKHCEELEVNQKQKEELILDHEEKYKSQINTLQEA
LEAQEAQHKELVDVKEAFTGLTTELENSRKKMQELELDLQSSVGEARKFEEQSHQIGSHA
ETETQRALEFERMLELAKGSAKEMQYQTASLQDELKDLYKKIAESQQVEESLRSTTAELS
AVQEQFELSKSLVSDLQKQVASEEDVKNALNQELDSHKASDMRVKDDILALENLLSSTKG
DFQVKVAELEDIKMKLHEEVETKKMVEDRLKSQEENISTLQEELAKVVSEKVSLEAVVVD
LNTNVLQMKELAGDLETKLKLSDENFSKADALLSEALSNNVELEHKLKSLDELHQEVGSV
AASTTQKNLELEDILQASSAAAEEAKSQLREIETKLISNEQKNLELEQQLNMVELKSSDT
ERELKEIIEKTSELNVKLIGLEEEKVLLQNEKHEYQEKLTQLETALSQSSSRNLELEQEL
KDVAEKCAKHEAHATTTNQRGLELEELVQISESKVKDAGNKVAELELLGETTNYRIKELE
EQISTLETKSNDKEEEHKHLSDKVSELAAQLEIFQGKASHLELELQAANEKDKELSESLN
LALEEKLKFEDMSNSSSKKLSETENLLGVLQNELKLAHEKLEGIEQDLKVSGIRESEIME
KIRSAEEQLEHQGRIIEQATTRNSELESLHESLLKDSEIKLQEATANFTNRDSEANSLYE
KLKMLEDQKRTYEEQVAEANERSGSLKAELNEISLKLVAQENIIEELKGKVEEANNKTGQ
SISDNELLAETNLQLKSKIDELQELLSSSLAEKEATSHQLTYHMDTLAELTDQHSRLTEI
HSATESRVREAEVQLQEAIEKFSQRDSEAKDLNEKLHALESEIRLYEETANEASATAQKQ
KSELEEAHLKVKHLDSVLQDLQSKASQIEKDNEELAVTNLRLTQELVAHESKVSAIIEEN
NTLNETYQIERKELQEVINKLEGQKNEQKESEDSLKAEAESLKAELAEKSVVGVHVVELK
QQLALLEARIKEEKESDLLKESEREVISKNSLEELESKCKQVLLLEKQVEELEQKLHLAD
AKSIETSWMI
Download sequence
Identical sequences A0A2G5D2N9
Aquca_030_00359.3|PACid:22035701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]