SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_030_00381.1|PACid:22035628 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_030_00381.1|PACid:22035628
Domain Number 1 Region: 2-135
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.81e-17
Family SPT5 KOW domain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_030_00381.1|PACid:22035628
Sequence length 135
Sequence
MVKFLKPNKAVIVLQGRFAGRKAVIIRQFDEGTRDRPYGHCLVAGIAKYPKKVIRKDSAK
KTAKKSRVKAFIKLVNYNHIMPTRYTLDVDLKDVANLETFQSRDKKVTAAKEIKSRLEER
FKTGKNRWFFSKLRF
Download sequence
Identical sequences A0A2G5D2R1
Aquca_030_00381.1|PACid:22035628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]