SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_032_00072.2|PACid:22057301 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_032_00072.2|PACid:22057301
Domain Number 1 Region: 7-177
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-17
Family Ankyrin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_032_00072.2|PACid:22057301
Sequence length 295
Sequence
VEYPEEYPLTTSHDTVLHIAMYSGQNELVKNLLDILLQVPTTTNKSDILLKVNDFGDTIL
HEATTTNKIDPDTVSLILRKRPGLLTMHNNNGELPLFRAVRFGNEKMFEYLADLVDAQPD
PEAHRIRNDGVNILHIAILNESFELALKIAKKYPYLLDKRDQVGMTGLHLLSSMPLAFKS
GCKHGWLRRFIYFCVPNSDTHEDVSESDRVGQGNDGVINEQNIAESKVAPVYGQKNKSKK
TKAPNTCIKVYRTIALGLHWINQLCWNRIFRGSLFISLISNLKCHAFTSYVAPYT
Download sequence
Identical sequences A0A2G5D001
Aquca_032_00072.2|PACid:22057301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]