SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_032_00072.3|PACid:22057302 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_032_00072.3|PACid:22057302
Domain Number 1 Region: 5-157
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000656
Family Ankyrin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_032_00072.3|PACid:22057302
Sequence length 275
Sequence
MYSGQNELVKNLLDILLQVPTTTNKSDILLKVNDFGDTILHEATTTNKIDPDTVSLILRK
RPGLLTMHNNNGELPLFRAVRFGNEKMFEYLADLVDAQPDPEAHRIRNDGVNILHIAILN
ESFELALKIAKKYPYLLDKRDQVGMTGLHLLSSMPLAFKSGCKHGWLRRFIYFCVPNSDT
HEDVSESDRVGQGNDGVINEQNIAESKVAPVYGQKNKSKKTKAPNTCIKVYRTIALGLHW
INQLCWNRIFRGSLFISLISNLKCHAFTSYVAPYT
Download sequence
Identical sequences A0A2G5D005
Aquca_032_00072.3|PACid:22057302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]