SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_032_00094.1|PACid:22057269 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_032_00094.1|PACid:22057269
Domain Number 1 Region: 379-677
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.45e-54
Family WD40-repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 50-115
Classification Level Classification E-value
Superfamily RING/U-box 2.91e-18
Family RING finger domain, C3HC4 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_032_00094.1|PACid:22057269
Sequence length 682
Sequence
MMMGEGSVGALVPSVKAESRTTSATTATETALAIVSAEATTTRMVELGGEIDKDLLCPIC
MQIIKDAFLTVCGHSFCYMCIITHLNNKNDCPCCAHFLTSSQLFPNFLLNKLLKKTSARQ
IAKTASPIEHLRQALHQGYDASVKELDSLLSLLAEKKRKKEQEEAESNMLVLLDFLHCLR
KQKVDELNEIQNDLQYIKEDINSVERHRMELYRTRERYSLKLRMHLDEPPASKGWPSSTD
KQSSGLMSSARSLQGGIGSGNFQKKKADIKASISSQGLQRKEAFSGSESQSVIQSGLAVA
RKKRIHTQFNDLQEYYLQKRRNLASQGHKQEERDMNTIKREGYHAGLEDFQSVLTTFTRY
SRLRVIAELRHGDLFHSANIVSSIEFDRDDEFFATAGVSRRIKVFEFSSVVNEPADAHCP
IVEMSTRSKLSCLSWNKYTKNQIASSDYEGIVTVWDVTTRQSVMEYEEHEKRAWSVDFSR
TEPSMLVSGSDDCKVKVWCTKQEASVLNIDMKANICCVKYNPGSSFHVAVGSADHTIHYY
DLRNTSAPLHVFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKENLPVRTFRGHANEK
NFVGLSVNSEYIACGSETNEVFVYHKAISKPATSHEFGSPDMDDTDDGAGSYFISAVCWK
SNSPTMLTANSQGTIKVLVLAA
Download sequence
Identical sequences A0A2G5D041
Aquca_032_00094.1|PACid:22057269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]