SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_034_00001.1|PACid:22056663 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_034_00001.1|PACid:22056663
Domain Number 1 Region: 57-97
Classification Level Classification E-value
Superfamily F-box domain 0.000000327
Family F-box domain 0.0029
Further Details:      
 
Weak hits

Sequence:  Aquca_034_00001.1|PACid:22056663
Domain Number - Region: 291-455
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0288
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_034_00001.1|PACid:22056663
Sequence length 471
Sequence
MEKGNRLNKLSLPLLRVCDNKIQKRKSSSPPCVCDGMERDRMKMSKRNCYICAFETDRMR
NWSTLPSHLLDLIAECLDLPDLLRFGFVCQTWKSVCGPLQFRNHLPWLIVPIKNAASNTM
TFDDKDNVGFFSLCDDKIYKAEIPELSNRRICASLPGGWLMTVHENSEIQLFHPFSPKLS
LIHLPPLMELPCVLGTIKKEGVASPLYYIITKFGSPEPRFFPPAYVRDHCIHKVAMSSSL
ITSDTIIMIIQDAGHSMAFYRFGGNQEKWVPATQNQNHYNFQDITYHSGKFYAVHSNGYV
IAIQGLDDTETLPYGEQVISQHPGDLAPRYYILESSGDLLVVLRYSVNLGEKDPNDMLQV
RPFKTVGFKVFKIEFGVPDNKWVQIHNLGDRSLFLGYNSSFSLSSTHFSGCKPNHVYFTD
DLGHCCYSEGHGGHDLGIFNLEDGGIETFLYPSNTLLVTPPPIWFAPNIVS
Download sequence
Identical sequences A0A2G5CFG7
Aquca_034_00001.1|PACid:22056663 Aquca_058_00226.1|PACid:22051042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]