SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00100.1|PACid:22061409 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_035_00100.1|PACid:22061409
Domain Number 1 Region: 13-159
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000435
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00100.1|PACid:22061409
Sequence length 176
Sequence
MDLFNRVSRGDLEYLKKVELDVLLNSRDQDRSSVLCIATRCNQLDCCKEILKRCSSLLYH
QNHEDKSVLHHAVCVTDYRLMDFFLSAGLDATKSEGDAENMIRYKKWINLQSVGNTALIV
AISRKNYYVVKKFVDVDSQYKLSLSGMIKAYKMIKMLTDSRYTDHGYGANVRIVAQ
Download sequence
Identical sequences A0A2G5CW61
Aquca_035_00100.1|PACid:22061409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]