SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00127.1|PACid:22061028 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_035_00127.1|PACid:22061028
Domain Number 1 Region: 29-84
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000772
Family F-box domain 0.0039
Further Details:      
 
Domain Number 2 Region: 149-242,270-365
Classification Level Classification E-value
Superfamily L domain-like 0.00000408
Family Internalin LRR domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00127.1|PACid:22061028
Sequence length 453
Sequence
MKKGFLKKNVTENVKVKEKINKEDLRLPKVDRLSVLPKVLLHHILSFLDIKEVLRTCILS
RRWRYLWIDLHVLNIDDKFWLDINGEVKTDKFQTYVNKFLLQRDGSNIEKFSLIYENEKS
GYVVDDYMDKIYTWVVSVVRRNVEDLHLQVQYMPPLFSFCYSTKLKTLRLTNATLPVQVE
GSWCPPSLESLIIENCCHQYLEDINISALQLKYLKVINKHDSIFVGPYQCELKICAPNLT
SLECIGYMYQNYHLENLSSVVFARIDTKKYRDHNTKTFLVMALKNLFRGLVSTKSLLLSV
EGIQTFADLQTLFKPVVISFPNLKYLKLTEWRHDCFISTLAKLFEGFSCIETLVMERMKV
SYKPPKQEVHWGKQLVFNCMLHKLKSVRMQNLKGCENELRFIEVLLEKAMVLEDIAITTT
KEHTSDSEKKLEEFIKKLQSLPKASSSATILCN
Download sequence
Identical sequences A0A2G5CWA4
Aquca_035_00127.1|PACid:22061028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]