SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_037_00277.6|PACid:22040561 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_037_00277.6|PACid:22040561
Domain Number 1 Region: 413-568,687-741
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000893
Family WD40-repeat 0.018
Further Details:      
 
Weak hits

Sequence:  Aquca_037_00277.6|PACid:22040561
Domain Number - Region: 1179-1287
Classification Level Classification E-value
Superfamily ARM repeat 0.0529
Family Clathrin heavy chain proximal leg segment 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_037_00277.6|PACid:22040561
Sequence length 1325
Sequence
EILNDSDSSSSSSSSSSPSFNLKDIQHKSYSDKSPNSLSKDEEIEKSSVSSPQTPVETLK
PEEKKVVESIISSFRSRKPGEFSRNSYSLGRSTTSRPLPTLYGGVRVNPKPGAALAAAAA
ASRSIPTPHAAAIKSRRATSEAALLNVVNSELDFVDGTEAVDTSDNVSVNVESETIKLDS
RIGDSDGNAEDSPIILAEHISGREDVAEISHENTEASSFEEACQTQEEATKVDEIELGTN
YNSNVDEGSTVLSSTDVVENEKQLIDASENADESNLSSTCTAASDENHIPPENEVNSKVE
ESSVLMASEIPDAEKSHRENGLALDDTDVVEDRVVQLNSKRGGKKSGKKLRSFMKPLDLA
EELEKKHAYSGLHWEEGAAAQPMRLEGIRRGPPAVGYLQIDANNAITRTISHQVFRRDHG
SPQVLAVHPNFIAVGMSKGFILVVPSRYSSQNADSMDAKMSVLAPQGDKSHSPVTSMCFN
PQGDLLLAGYGNGNIIVWDVQRSTTAKVITGEHTAPVVHTLFLGQEFQVTRHFKAVTGDC
KGLVLLHTFTGVPLLRFSIKTQCLLDGQKTGIVLSASPLLIEDCGSSTAAPGNATASSSG
IGSMMGGVVGSSLFNERSSLVEEGVVIFVTHQTALVARLSPNLEVYARLSKPDGVRDGSM
PYTAWKCMTLSQGSTENLEGETLEKASLVIAWDRKVQVGKLVKSELKIYTEWTLDSAAIG
VAWLDDQMLVILTLRRQICLFSKDGNELHRTSFPADGLGADDFIVYHTYLSNLFGNPEKS
YHNCLAVRGATIYVLGPTHLVASRLLPWRERIQVLRTAGDWMGALDMAMRLYDGHAHGVI
DLPRTLDAIREAIMPYLVDLILSYVDEVFSYISVASCNQIEREAQYARVGGVAVEFCVHI
KRIDILFDEIFSRFVAVQHGGTFLELLEPYILKDMLGCLPPEIMQALVEHYSSKGWLQRV
EQCVLHMDISSLDFNQVVRLCREHGLYGALIYLFNKGLDDYKAPLEELLLILQSSERDIA
ASIGYRMLVYLKYCFSGLSFPPGHGILPHTRLPLLRKELLEFLLEDSNEMNSKLVASFKS
QIGVFPNLFHLLRLDTEATLDVLKFAFPEEEANFNHGLLDANKEDNEENNDNNTEGLNSM
VQSTVNTLIHILDIDISDEEVSSGASDMEFIEIWPSKKDTGHLLEFIAYFVARKRATIAK
TVLNRILEFLTSESIFSLPSQNIDTCKRREKQMLTLLRVVPEADWNSSYVLPLCEKAHYY
QVCGYIYTTKRQYDAALDSYMKDLNEPIYAFSFINTMLLHLKDTESVNFRFAVVSKIPEL
FNLSR
Download sequence
Identical sequences A0A2G5CUE4
Aquca_037_00277.6|PACid:22040561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]