SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_037_00277.7|PACid:22040562 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_037_00277.7|PACid:22040562
Domain Number 1 Region: 413-568,687-741
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000654
Family WD40-repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_037_00277.7|PACid:22040562
Sequence length 1033
Sequence
EILNDSDSSSSSSSSSSPSFNLKDIQHKSYSDKSPNSLSKDEEIEKSSVSSPQTPVETLK
PEEKKVVESIISSFRSRKPGEFSRNSYSLGRSTTSRPLPTLYGGVRVNPKPGAALAAAAA
ASRSIPTPHAAAIKSRRATSEAALLNVVNSELDFVDGTEAVDTSDNVSVNVESETIKLDS
RIGDSDGNAEDSPIILAEHISGREDVAEISHENTEASSFEEACQTQEEATKVDEIELGTN
YNSNVDEGSTVLSSTDVVENEKQLIDASENADESNLSSTCTAASDENHIPPENEVNSKVE
ESSVLMASEIPDAEKSHRENGLALDDTDVVEDRVVQLNSKRGGKKSGKKLRSFMKPLDLA
EELEKKHAYSGLHWEEGAAAQPMRLEGIRRGPPAVGYLQIDANNAITRTISHQVFRRDHG
SPQVLAVHPNFIAVGMSKGFILVVPSRYSSQNADSMDAKMSVLAPQGDKSHSPVTSMCFN
PQGDLLLAGYGNGNIIVWDVQRSTTAKVITGEHTAPVVHTLFLGQEFQVTRHFKAVTGDC
KGLVLLHTFTGVPLLRFSIKTQCLLDGQKTGIVLSASPLLIEDCGSSTAAPGNATASSSG
IGSMMGGVVGSSLFNERSSLVEEGVVIFVTHQTALVARLSPNLEVYARLSKPDGVRDGSM
PYTAWKCMTLSQGSTENLEGETLEKASLVIAWDRKVQVGKLVKSELKIYTEWTLDSAAIG
VAWLDDQMLVILTLRRQICLFSKDGNELHRTSFPADGLGADDFIVYHTYLSNLFGNPEKS
YHNCLAVRGATIYVLGPTHLVASRLLPWRERIQVLRTAGDWMGALDMAMRLYDGHAHGVI
DLPRTLDAIREAIMPYLVDLILSYVDEVFSYISVASCNQIEREAQYARVGGVAVEFCVHI
KRIDILFDEIFSRFVAVQHGGTFLELLEPYILKDMLGCLPPEIMQALVEHYSSKGWLQRV
EQCVLHMDISSLDFNQVVRLCREHGLYGALIYLFNKGLDDYKAPLEELLLILQSSERDIA
ASIGNLRKLWEVR
Download sequence
Identical sequences A0A2G5CUF2
Aquca_037_00277.7|PACid:22040562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]