SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_038_00012.1|PACid:22026751 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_038_00012.1|PACid:22026751
Domain Number 1 Region: 638-783,811-945
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-72
Family Protein kinases, catalytic subunit 0.0000044
Further Details:      
 
Domain Number 2 Region: 476-575
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.61e-24
Family Flavin-binding PAS domain 0.0000241
Further Details:      
 
Domain Number 3 Region: 198-290
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.54e-23
Family Flavin-binding PAS domain 0.0000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_038_00012.1|PACid:22026751
Sequence length 970
Sequence
MLSSKAEFPNSPGSSSGKELSSNRDQGPKMEVLEPLSNEIQSQTSVKLHQGSARTPSGRE
PPNKWMAFANEGGKSKIKEDSKSGFTGSAQKSKASLKESNAGSSNVQISKLTTDVNLVER
ASEWGLVVTSEIEEGNPQSVRVRSARDMGKISVDRYIESTRTSEESNFGYEASVPRVSQE
LKDALASLQQTFVVSDATRPDCPIMFASSGFFSMTGYSSKEVIGRNCRFLQGPETDQKEV
AKIREAVKTGTSYCGRLLNYKKDGTPFWNLLTVSPIKGDNEKVIKFIGMQVEVSKYTEGL
IDKAVRPNGLPQSLIRYDARQKENAMCSITEVVQTVKNPKTSLEPRLPVPWTPGTPMGRE
KFNLDYFLPKSAEFGNLTTPSRQTPQADAKNDITRKSTTHDGHKKSRKSGRRSFMGFKGR
SSSTAEKSDQHIIEPEFLMARDIQHSDSWDRIERERDIRQGIDLATTLERIEKNFVITDP
RLPDNPIIFASDSFLELTEYTREEILGRNCRFLQGPDTDQGTVTKIRDAIREQREITVQL
INYTKYGKKFWNLFHLQPMRDQKGELQYFIGVQLDGSDHLEPLRSRLSENTEEKSAKLVK
ATAENVNEAVRELPDANLRPEDLWSMHTKPVFPRPHKKNNSSWIAIQKIIARGEQIGLKH
FNPVKPLGCGDTGSVHLVHRACIEREIMSHLDHPFLPTLYSSFQTATHVCLITDFCPGGE
LFALLDKQPMKVFKEESARFYAAEVVIGLEYLHCLGIIYRDLKPENVLLQKDGHIVLADF
DLSFLTSCNPKVLKHPLPAKRRKSMSQAPPAFFAEPITHSNSFVGTEEYISPEIITGAGQ
SSAIDWWALGIMLYEMIYGRTPFRGKNRQRTFANILHKDLTFPNSIPASLAARQLIHELL
QRDPANRLGSNGGANEIKQHPFFREINWPLIRCMNPPPLDVPLELVGIEPDSKAKAVQSE
DVVLRSLDIF
Download sequence
Identical sequences A0A2G5CS81
Aquca_038_00012.1|PACid:22026751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]