SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_038_00031.1|PACid:22026864 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_038_00031.1|PACid:22026864
Domain Number 1 Region: 158-447
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.19e-46
Family WD40-repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 128-152
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000014
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_038_00031.1|PACid:22026864
Sequence length 452
Sequence
MDLDNGGGKRVFTRLGGGGGGGGGHTQSSHMEPKVCFHWRAGRCNRNPCPYLHSELPQHS
NSNVKRGYGNGLPDNNNNHNNNDRSFAGQGFARRKPNNSNQQVNNKWGRGHGGSGAGGVG
AFRPPPKVQDKICHFWIDDKCSYGDKCRYLHQWFTSDSFTMLTQLPGHEKVISAIAFPMG
SDKLYSGSKDESVKVWDCQTGQCAGVVNLGGEIGCMISEGPWIFVGIPNEVKAWNTQTNT
DLRLSGPVGQVYALVVGNGMLFAGTQDGNILAWRFSATTNCFQPTAALKGHTLAVVSLVV
GANRLYSGSMDNTIRVWDLETLQCIQTLTDHTSVVMSVLCWEQFLLSCSLDRTVKVWAAT
ESGSLEVTYTHKEEHGVLALCGMHDAEAKPVLLCACNNNIVHLYDLPSFNERGKIFSKEE
IRAIEIGPGGLFFTGDGKGELRVWKWSETAPA
Download sequence
Identical sequences A0A2G5CSA2
Aquca_038_00031.1|PACid:22026864 Aquca_038_00031.2|PACid:22026863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]