SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_038_00114.2|PACid:22026822 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_038_00114.2|PACid:22026822
Domain Number 1 Region: 118-168,199-207
Classification Level Classification E-value
Superfamily F-box domain 1.7e-16
Family F-box domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_038_00114.2|PACid:22026822
Sequence length 262
Sequence
MSEIVERYEKLQLRVYLFRENYYYYPSVCKELSFILRNAYSKVPKILQSILFQDTLAAFQ
FLPQVQTGYGMEAANLLLQATEVALPKHKRGLAATEFKHAVVAYKRRQKVHKDVEGSAQL
PEDVLVHVFSFLDMHSLVAVGLVCRSWCSAANENKLWQSQYDIFFGCCNDDSKSKEQTSE
LAQKSTSSFNKKDERGLIIIDWREAFKQEYIGTSSWRFASNRGYCGICKSVVWISNMKCS
NVHYGTNIANQQINSLSSQQVG
Download sequence
Identical sequences A0A2G5CSP6
Aquca_038_00114.2|PACid:22026822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]