SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_038_00209.1|PACid:22026830 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_038_00209.1|PACid:22026830
Domain Number 1 Region: 19-492
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.91e-133
Family Pyridoxal-dependent decarboxylase 0.00000000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_038_00209.1|PACid:22026830
Sequence length 497
Sequence
MGSLGKSDPNLDDEFNPLDPEEFRKQAYQTIDFIADYYKNIDSYPVLSQVEPGYLRARLP
ESAPYRSEPFETILKDVNRDIIPGMTHWLSPNFFAYFPATVSTAAFLGEMMCTAFNSVGF
NWLAAPASTELELVVMDWLAQLLQLPKSFMHSGTGGGVLQGTTSEAILCTLVAARDRVLE
TIGDEKIAKLVVYGSDQTHSTLAKACKVAGILPRNTRLIPTTKHENFSLSSAQLRSAIEA
DVANGLVPIYLCGTVGTTSSNAVDPLDQLADVASDFGMWFHVDAAYAGSACICPEFRHFL
NGVERANSLSLSPHKWLLTYLDCCCLWLKEPASIIKVLSTDPEYLKNKPSELNSVVDYKD
WQIGFGRRFRALRLWFVLRSYGVAKLQIHIRSDVEMAKMFEEYVRSDPRFEIVVPREFAL
VCFRLTAIHNSDSLELLNPKLLNWVNTSGRMYMTHTVIGGTYILRFAVGSTLTMEGHVSA
AWHLIKEGADKLLRENN
Download sequence
Identical sequences A0A2G5CT19
Aquca_038_00209.1|PACid:22026830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]