SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_041_00168.1|PACid:22029247 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_041_00168.1|PACid:22029247
Domain Number 1 Region: 117-158
Classification Level Classification E-value
Superfamily F-box domain 0.000000113
Family F-box domain 0.0049
Further Details:      
 
Domain Number 2 Region: 6-107,232-441
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000306
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_041_00168.1|PACid:22029247
Sequence length 473
Sequence
MFGCVDNLAHTCDVFKLDISTMDWVRVNSLGDRIFLLGLISSTSLSANESSLKANCIYFS
LSGGTRLYMFDMHDGTITTILPCPKIPYWRGPFWVVPNCKPQVKKDMVNLEESIQQGGNQ
EWSWKDLPVELLELIVSFLFLGDCIRFRLTCKSWISITPPLRSNCVFNKFESEPQQLVPW
LMSFPKNNQGIWKLHHPIYGDAYTMNIPELAGAIIRNAKYGWLLMSRGTSFFFFNPITME
VVKLPDMEEDYEFIGMSFSSPPTSSDFVVFGFLGFYMVVYRKGEEKWSEDCFKTHWEFLN
SPCNPIFYDGVFYCLGKNGRLGLFDTKVITEEPQWRIVESAVFSISLKSDLINSSETFIV
EYDGEIISIFVSHQGQQISIFKLDLSNLKWCRLESLDDKVLFLSHTASMLLPTVGLKGIE
NRIYFPRFHETDNMFYSLSTRKYHCCGSQYSSEDWINTRQLSHTQCTWIQSTN
Download sequence
Identical sequences A0A2G5CQF8
Aquca_041_00168.1|PACid:22029247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]