SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_042_00159.1|PACid:22033011 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_042_00159.1|PACid:22033011
Domain Number 1 Region: 14-309
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.85e-45
Family Cell cycle arrest protein BUB3 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_042_00159.1|PACid:22033011
Sequence length 344
Sequence
MTVIIPSPPPPYSGRELSNPPSDGITNLIFSNHSDDLLLVSSWDKSVKLYDASANVLRGE
FKQENAVLDCCFHDDSSGFSAGLDTTVRRCIFTCGKEDILGKHDAPVRCVEYSYASGQVI
SGSWDKTVKCWDPRGTNGKEHTLVGTYLQPERVYSLSLVGNRLVVATAGRHLNVYDLRNM
SKPEQWRESSLKYQTRCVRCYPNGTGFALSSVEGRVAMEFFDLSEAGQAKKYAFKCHRKS
EDGKDIVYPVNSIAFHPIYGTFATGGCDGFVNVWDGNNKKRLFQYSKYPSSIAALSFSRD
GRMLAVASSYTYEYGNKPHEPDTIFVRDVKDIEVKPKPKVYPTP
Download sequence
Identical sequences A0A2G5CPH5
Aquca_042_00159.1|PACid:22033011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]