SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_049_00058.3|PACid:22044555 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_049_00058.3|PACid:22044555
Domain Number 1 Region: 26-259
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-53
Family Ankyrin repeat 0.0000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_049_00058.3|PACid:22044555
Sequence length 262
Sequence
KPQNRKTIPSTFQTLLMASSDSKTHQLLEAAFYGELRRVKKFASELDNGRGIAQTLATVK
DNMNQTAIHTAAQEGMVNICKFWIDDLKLEVDPKDAKGYTPLHRACEGGHLSTAVYLLKK
GADPEMRSNRGFNSLHIAAEKGSEELVRLLLSKGADVDALSRSGTPLNLAAGQGKHEVVK
VLLDHCANPNFYLHHVPTPLSAAILAKSLCCVELLIAAEADLDAISCGVTPLHLAASEGQ
TEIIKCLLKAGADPDVTDMGSS
Download sequence
Identical sequences A0A2G5CJL0
Aquca_049_00058.3|PACid:22044555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]