SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_049_00130.1|PACid:22044798 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_049_00130.1|PACid:22044798
Domain Number 1 Region: 74-135
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000301
Family F-box domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_049_00130.1|PACid:22044798
Sequence length 435
Sequence
MVKDQKMGNEEHLTNNQEEEEEEEEEEEEEEEEEEEEDDDDEEEDYDYDDDDELLEEDEE
ENFEEDGFEDVLQTSGMMAKLPVEIFFEILSRVPVKSLSQCRKVCIAWYNSIQHPLFIKM
QHNRAIKSNSHFVILYELRTKQYYLVDYESLDGLEITQISQIPKMPYVYANLDSCNGLIY
RREQTSFVMNPITGDFMLLPDSPKYYLEDIKRKEIEKYGCSLGRKCQCCEMETEIYTFSS
GTWETIYDVPYNLEYNDTNAFVNGAFHWIGVDRGKPKAPQVIVSFRLCTEDFQEIALPHG
VHLNKDCQLCVLGGCLCLNCDFSDWRAEIWVMKDYGIPGSWSREYVIENMKPWSEPYVPL
KLMDNGEILLMSDDSIMGYYDPEKGTYKLINLYEFLPDRRHIGQSLIHVGSLISPQNISR
LLFIEHITRSPRLIL
Download sequence
Identical sequences A0A2G5CK32
Aquca_049_00130.1|PACid:22044798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]