SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_049_00181.1|PACid:22044789 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_049_00181.1|PACid:22044789
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.38e-23
Family Cyclophilin (peptidylprolyl isomerase) 0.0000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_049_00181.1|PACid:22044789
Sequence length 95
Sequence
MVKKKNPLVFLDVSIDGSRPEKIAMELFSDVVPKTAENFRALCTGEKGIGATTGKPLHFK
GSIFHRIIPGFMAQVLVKLLYMSHDLSFLHSIEFV
Download sequence
Identical sequences A0A2G5CKB1
Aquca_049_00181.1|PACid:22044789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]