SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_051_00011.2|PACid:22046138 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_051_00011.2|PACid:22046138
Domain Number 1 Region: 55-360
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-57
Family WD40-repeat 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_051_00011.2|PACid:22046138
Sequence length 452
Sequence
MRIRTISRQPEQFTRERSNDLRKVHRNYEPSLHPLANATGYSRALTAVKLDKIFARPFMH
DLSGHMDSISCMTKNQNHLKDIFSGAMDGEIRHWDLASRKTVRQFHGHQGAVRGLTTSTD
GRILVSCGTDCTVRLWSVPVAGGMELNDSFDHSSEPLAIYVGKNAFWAVDHQWDGRHFAT
AGAQVDIWDHNRSEPINSFEWGKDTVTSVRFNPGEPDLLATSSSDRSITLYDLRLSTPVR
KLIMKTKTNSICWNPMEPMNFTAANEDCNCYSYDARKLNEAKCVHKDHVSAVMDIDYSPT
GKEFVTGSYDRTVRIFRYNGGHSREIYHTKRMQRVFSVKFTCDGSYVVSGSDDTNLRLWK
AKASEQMGVIIGRERRNHELKEALIKQYQHLPEVNRVIRHRHLPKPIYKARILRRIMLEA
ERRKDQNRRAHSAPGSMPVQPMRKKRIAAEIE
Download sequence
Identical sequences A0A2G5CJ50
Aquca_051_00011.2|PACid:22046138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]