SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_056_00103.1|PACid:22060723 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_056_00103.1|PACid:22060723
Domain Number 1 Region: 23-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-21
Family B3 DNA binding domain 0.00093
Further Details:      
 
Domain Number 2 Region: 549-608
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000235
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_056_00103.1|PACid:22060723
Sequence length 618
Sequence
MEACQECAKRCLNKNPSSVLPVVPSFFKVLVDEHEKFMKFLTIPPKFSPAIVPLVDQKID
LEDSKGQRWSVQVSRLGERLVFQNGWDQFASDHFLETGDFLVFSYFIGSHFIVQIYCRSG
CPKLNFPEKFSGSRESSDVDMSVDPPTSDDKTLTPEEVSPQMNDKSSKNEQGSCSSVHSD
WNVDRSRIPCNVPIAEKIPTSTAMRTPCNNNTAKSKPVLDDGCTEVPFYMIDRTFIDVEN
VGTCLFDLSEFELVKGRSAVNVEKPVVMENGRSPNCVAESVPPQTRQGTDCFEDYCNIFN
TRPGDTERKCRGDPLDVADLGVSERRYHSQYIDKVPLFKENSSATGCISRQPERECESGK
KASLFKDKNSMNVTSPRQPQTRLKADCAGNGMGNTDFSGAFCKPLPEKRKSVFSEMDAVS
QLNQNIFAGSCGSVTNTKKMVSGFGNDFSMGRNDYLTGKKMKVGKEEHLEKNDEKLGKRP
AVVKCELQEEVYPSLKFQGQASNMVKTENIDSGWSSPFSSNDYCSSVTAVTRSFLEFPTD
RPPIVGFGRKRMDRKIILIRDPSRRLWPVLYLQSSGFKVLGAGWALVAKANNIREGDQCI
FAIDNGSEGTFGLSIARK
Download sequence
Identical sequences A0A2G5CGM9
Aquca_056_00103.1|PACid:22060723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]