SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_058_00018.1|PACid:22050911 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_058_00018.1|PACid:22050911
Domain Number 1 Region: 206-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-61
Family Protein kinases, catalytic subunit 0.0000898
Further Details:      
 
Domain Number 2 Region: 53-178
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-22
Family Ankyrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_058_00018.1|PACid:22050911
Sequence length 481
Sequence
MENIAAQLKRGISRQFSTGSLRKNSGTFSFTRQSSLDPRRHNNLRFSFGRQSSLDPNRTA
TSGGTPLDQLSVPDNLDSTMHLLFMASQGDVASVQDLLTNKAVDVNSIDLDGRTALHIAA
CEGHVDVVKLLLTNKANIDARDRWGSTAAADAKYYGNVDIYNILKARGAKVPKVRKTPMT
VSNPREVPEYELNPLELQVRKADGISKGSYQVAKWNGTKVSVKILDKDSYSDPDSINAFK
HELTLLEKVRHPNVVQFVGAVTQNIPMMIVSEYHPKGDLGSYLQKKGRLSPSKALRFALD
IARGMNYLHECKPDPIIHCDLKPKNILLDSGGQLKVAGFGLVKLSKISAKKAKLSQPEAF
VDRSNMYVAPEIYKDEIFDRSIDAFSFGLILYEMIEGAPPFHPKPPEEVAKLICIEGTRP
PFKLIKSKGYPTDLKELIEECWDPAPVVRPTFSEVIVRLDKIVSSCSKHGWWKDTFKLPW
K
Download sequence
Identical sequences A0A2G5CE80
Aquca_058_00018.1|PACid:22050911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]