SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_058_00068.1|PACid:22051126 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_058_00068.1|PACid:22051126
Domain Number 1 Region: 495-788
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-74
Family Protein kinases, catalytic subunit 0.0000982
Further Details:      
 
Domain Number 2 Region: 28-285
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.63e-31
Family beta-lactamase inhibitor protein-II, BLIP-II 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_058_00068.1|PACid:22051126
Sequence length 918
Sequence
MNKWRAEHCIGIVILVACSSNSIWLVLGLGSMSSIAVSYGENGPVFCGLRSDGSHLVTCY
GGDSAVIYGTPPRFPFLGLTAGDGFVCGLLMESSQPYCWGNSIYIEMGVPQPMIEGATYS
EISAGDHHLCALRKQNIGKLHEDTTSIVDCWGYNMTANYAFSGQLKSISAGSVFSCGLFS
ENRTVFCWGDETASNVISLIPKKKRFQKISSGGYHVCGVLEGEDSRVFCWGRSLVMEKEM
YVAAYSGEGNDVDLVPSEPMISVIGGRFHACGIKASDRGVMCWGFRISKSTATPTGVKVY
ELAAGDYFTCGVIAVKSLQPICWGLGFPTALPVAVSPGPCTPNPCNDGFYELNHHGNKLC
KSPDYRVCLPCTNCTTEMYETTQCKQMSDRHCEFNCSRCVSADCLAKCSSPSNIGIAKKK
DTRFWALLQMPIFVAELVFAVLLVCVVSLASCLYVRYRLQNCQCSQTNSKAIANNGSLPS
LHKEISRIKPEIEERKIRRARTFTYEELERATDGFKEESQVGKGSFSCVFKGVLKDGTVV
AVKRAIITTDLKKNSKEFHTELDLLSRLNHAHLLNLLGYCEEGHERLLVYEFMAHGSLHQ
HLHGKNPSLKQQLDWVRRVTIAVQAARGVEYLHGYACPPVIHRDIKSSNILIDEEHNARV
ADFGLSLLGPADSGSPLAELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVLLLEILSGRKA
IDMQFEEGNIVEWAVPQIKAGDLAAILDPALKPPAHLEALTRIANIACRCVRMRGKERPS
MDKVTTALEQALAHLMGNPSNEQPILPTEVVLGSSRLHKSSRRSSNRSGSEATATHDVME
PEDDQRIEFRAPSWITFPSVTSSQRRKSSVSEDVDVEGKTPDTTRPRVGSGGNDGLRSLE
EEIKPASPRQSLFLQHNF
Download sequence
Identical sequences A0A2G5CEM0
Aquca_058_00068.1|PACid:22051126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]