SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_062_00005.2|PACid:22033308 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_062_00005.2|PACid:22033308
Domain Number 1 Region: 345-476,580-634
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.87e-16
Family WD40-repeat 0.082
Further Details:      
 
Domain Number 2 Region: 133-193
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000114
Family RING finger domain, C3HC4 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_062_00005.2|PACid:22033308
Sequence length 644
Sequence
MPPRTNIRGRGPHGGPHVVFHPRDIEDYFDIEEEAEILEYDDEQVEDEEEDDDDDDDDED
DESEEEEEEEDYLPIIRTNGRVSPNTRLNPARRIVFEDDSEPQPIQQQGQEDSKIESEGI
IIRSTGESSGSGNDNEGVCCPICMESWSSEGGHQVCCLPCGHVYGFSCIEKWIRQCKRNC
AKCPQCSRKCGIKDIIKLYISRIAVVDGEQQKKVLSLHAENEFLKMKIASLQERICQEEE
EKMLKDEASCLENMCFGEMRGQTSEFIAKSNDSHGQTQFGHTSTYGGQGSLCCSLKLEEE
FVVDGARVFDMDTSNRALILARRLPGMGGTHVLTKMSMMYPYESETIQLPISTKAVKDLH
VSPCGGKLALFASLGKKLSILSLESNNIVLTYDLPGPAWSCSWDVNGPQHLYAGLQDGTI
LMFDMRQTARPIESINGLSRHPIHTLHSLVQKSTTPCDAKTLLSASSIGPCVWNTGSARE
RPFLLAEMENQGVCISLAHCLSTDDIVASFRPKVQTSNDIINTQPSLSPSPTVLGRGILG
SHVLIKRVGGNCYQNLGCVSANVNDVRMLKSAIVKIENCNPMFAYGDEFTRGLSLLELPS
LKSVQSLKPHQHPILDVKYAASIGSGILGCVSEDRLQLFAATPV
Download sequence
Identical sequences A0A2G5CE33
Aquca_062_00005.2|PACid:22033308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]