SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_068_00021.1|PACid:22057713 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_068_00021.1|PACid:22057713
Domain Number 1 Region: 783-1072
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-68
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 79-434
Classification Level Classification E-value
Superfamily RNI-like 3.14e-61
Family 28-residue LRR 0.054
Further Details:      
 
Domain Number 3 Region: 334-674
Classification Level Classification E-value
Superfamily RNI-like 3.69e-60
Family Rna1p (RanGAP1), N-terminal domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_068_00021.1|PACid:22057713
Sequence length 1086
Sequence
MVKLIRVKLIIESLLSLAKSLTLPNSVQLTWNSSTSTQWVGIECDNNHKVITLNLSGYEI
SGKLGPEIGKLKFLKTVDFGINYLSGSIPVEITNCTQLEYLDLSTNSLTGKLPENLGNLQ
NLVYFSVWGNGLSGSIPTSLFTIPNLATVYLNENDLSGFLPLNVGNASKMQILWLYSNSL
SGTLPDSIGNCSELIELSLNNNMFSGVLPKSFNSLENLVYVGMSWNSFEGRIPFGLGNCK
NLTELALSSNRFSGEIPPGLGKCSNLTTFAAINNSLTGHIPSSLGLLVKLSTLYISENHL
TGRIPPEIGNCRSLTSLFLNNNHLEGEIPSELGMLSMLSTLQLFDNSLSGEIPLGIWKIQ
TLEVLEVYNNSLSGELPVEITELKHLRNISLFNNHFSGVIPQTLGINSGLEKLDLTSNTF
TGEIPPNLCYGKQLRLLILGSNKLQGSIPSDVGNCSTLERLRLLQNNLTGFLPDFVSNSK
LHFMEISDNNIDGPIPSSLGNCLNLSSINLSSNKLSGPIPAELSNLVELQTLDLSRNQLQ
GPLPSQISKLVKLYSLNIGFNSLNGTIPSSLRSLKQLNTLKLSENRFSGEIPDFLPELER
LLELQLGGNLLRGNIPSSLGQVKSLAYALNLSGNKLTGQLPPELGGLSMLQRLDISRNNL
TGTLETVGKLDSLIEVNVSHNLFQGPIPVSLLKLSPSSFMGNPGLCVPCQEESRVNCGSN
IKASPCARPLSDSKGLSGVNIAIIVLGTSLICVLVVLLSSCVFRRCKKPGKGVGIFAHEG
PSSLLNKVMEATEHLNEKFIIGRGAHGTVYKASLSHDKSYAVKRLMFTNQSRANASMVRE
IQTVGQIRHRNLVKLEEFWLRKDNGLILYNYMQNGSLHDVLHEIKPAPNLEWDVRYRIAM
GTAQGLVYLHYDCDPAIVHRDIKPQNILLDSDMEPHISDFGIAKLMDQSSASVHSSTVMG
TLGFIAPEAAFTPVKTRESDVYSYGVVLLELITRKKAVDSSFPDHMDIVAWVRSMWNDTQ
DIDFIVDPSLVEEFMDSAVVEEVVEVLMVALRCTEREPRVRPMMRDVVKQLEDAKHQVRL
QQKQFK
Download sequence
Identical sequences A0A2G5CBD7
Aquca_068_00021.1|PACid:22057713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]